Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN503200 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Zinc Finger Protein 699 (ZNF699) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ZNF699 antibody: synthetic peptide directed towards the N terminal of human ZNF699
- Description
- Affinity Purified
- Reactivity
- Human, Canine
- Host
- Rabbit
- Antigen sequence
EEDLQTVKRELIQGIFMGEHREGFETQLKTNESVA
SQDIC GEKISNEQKI- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Alcohol dependence is associated with the ZNF699 gene, a human locus related to Drosophila hangover, in the Irish Affected Sib Pair Study of Alcohol Dependence (IASPSAD) sample.
Riley BP, Kalsi G, Kuo PH, Vladimirov V, Thiselton DL, Vittum J, Wormley B, Grotewiel MS, Patterson DG, Sullivan PF, van den Oord E, Walsh D, Kendler KS, Prescott CA
Molecular psychiatry 2006 Nov;11(11):1025-31
Molecular psychiatry 2006 Nov;11(11):1025-31
No comments: Submit comment
No validations: Submit validation data