Explore
Validate
Learn
ELISAAntibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- ELISA [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00010210-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00010210-M01, RRID:AB_489843
- Product name
- TOPORS monoclonal antibody (M01), clone 5G11
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant TOPORS.
- Antigen sequence
SPDSKCPICLDRFDNVSYLDRCLHKFCFRCVQEWS
KNKAECPLCKQPFDSIFHSVRAEDDFKEYVLRPSY
NGSFVTPDRRFRYRTTLTRERNASVYSPSGPVNRR
TTT- Isotype
- IgG
- Antibody clone number
- 5G11
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Mitotic phosphorylation stimulates DNA relaxation activity of human topoisomerase I.
Hackbarth JS, Galvez-Peralta M, Dai NT, Loegering DA, Peterson KL, Meng XW, Karnitz LM, Kaufmann SH
The Journal of biological chemistry 2008 Jun 13;283(24):16711-22
The Journal of biological chemistry 2008 Jun 13;283(24):16711-22
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged TOPORS is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to TOPORS on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to TOPORS on formalin-fixed paraffin-embedded human lung, adenosquamous cell carcinoma. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol
