Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00059286-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00059286-M01, RRID:AB_509376
- Product name
- UBL5 monoclonal antibody (M01), clone 2F7
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant UBL5.
- Antigen sequence
MIEVVCNDRLGKKVRVKCNTDDTIGDLKKLIAAQT
GTRWNKIVLKKWYTIFKDHVSLGDYEIHDGMNLEL
YYQ- Isotype
- IgG
- Antibody clone number
- 2F7
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Human UBL5 protein interacts with coilin and meets the Cajal bodies.
Svéda M, Castorálová M, Lipov J, Ruml T, Knejzlík Z
Biochemical and biophysical research communications 2013 Jun 28;436(2):240-5
Biochemical and biophysical research communications 2013 Jun 28;436(2):240-5
No comments: Submit comment
No validations: Submit validation data