Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN311539 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Chromosome 8 Open Reading Frame 84 (C8orf84) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-RPESP antibody: synthetic peptide directed towards the C terminal of human RPESP
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine
- Host
- Rabbit
- Antigen sequence
WMQYLREGYTVCVDCQPPAMNSVSLRCSGDGLDSD
GNQTL HWQAIGNPRC- Epitope
- C-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Expressed sequence tag analysis of human RPE/choroid for the NEIBank Project: over 6000 non-redundant transcripts, novel genes and splice variants.
Wistow G, Bernstein SL, Wyatt MK, Fariss RN, Behal A, Touchman JW, Bouffard G, Smith D, Peterson K
Molecular vision 2002 Jun 15;8:205-20
Molecular vision 2002 Jun 15;8:205-20
No comments: Submit comment
No validations: Submit validation data