Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
- Immunoprecipitation [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00004745-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00004745-M01, RRID:AB_489826
- Product name
- NELL1 monoclonal antibody (M01), clone 6A8
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant NELL1.
- Antigen sequence
CRRMSCPPLNCSPDSLPVHIAGQCCKVCRPKCIYG
GKVLAEGQRILTKSCRECRGGVLVKITEMCPPLNC
SEKDHILPENQCCRVCRGHNFCAEGPKCGE- Isotype
- IgG
- Antibody clone number
- 6A8
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Systematic association mapping identifies NELL1 as a novel IBD disease gene.
Franke A, Hampe J, Rosenstiel P, Becker C, Wagner F, Häsler R, Little RD, Huse K, Ruether A, Balschun T, Wittig M, Elsharawy A, Mayr G, Albrecht M, Prescott NJ, Onnie CM, Fournier H, Keith T, Radelof U, Platzer M, Mathew CG, Stoll M, Krawczak M, Nürnberg P, Schreiber S
PloS one 2007 Aug 8;2(8):e691
PloS one 2007 Aug 8;2(8):e691
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of NELL1 expression in transfected 293T cell line by NELL1 monoclonal antibody (M01), clone 6A8.Lane 1: NELL1 transfected lysate(89.607 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to NELL1 on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoprecipitation of NELL1 transfected lysate using anti-NELL1 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with NELL1 MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol