HPA028427

antibody from Atlas Antibodies

Targeting: TPD52 D52, hD52, N8L

Antibody data

Submit

Validation data

Product number: HPA028427 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA028427, RRID:AB_10610561
Product name: Anti-TPD52
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: MDLYEDYQSPFDFDAGVNKSYLYLSPSGNSSPPGS PTLQKFGLLRTDPVPEEGEDVAATISATETLSEEE QEELRRELAKVEEEIQTL
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

TPD52 protein structure - HPA028427 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human prostate and skeletal muscle tissues using Anti-TPD52 antibody. Corresponding TPD52 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex, kidney, prostate and skeletal muscle using Anti-TPD52 antibody HPA028427 (A) shows similar protein distribution across tissues to independent antibody HPA062167 (B).
Antibody #2 product nr: HPA062167
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human tonsil shows strong cytoplasmic positivity in most cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human prostate shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skeletal muscle shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney using Anti-TPD52 antibody HPA028427.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex using Anti-TPD52 antibody HPA028427.
Sample type: HUMAN