HPA010641

antibody from Atlas Antibodies

Targeting: CYB5R1 humb5R2, NQO3A2

Antibody data

Submit

Validation data

Product number: HPA010641 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA010641, RRID:AB_1078600
Product name: Anti-CYB5R1
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: TLLDPNEKYLLRLLDKTTVSHNTKRFRFALPTAHH TLGLPVGKHIYLSTRIDGSLVIRPYTPVTSDEDQG YVDLVIKVYLKGVHPKFPEGGKMSQYLDSLKVGDV VEFRGPSGLLTYTGKGHFNIQPNKKSPPEP
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

CYB5R1 protein structure - HPA010641 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex, kidney, pancreas and testis using Anti-CYB5R1 antibody HPA010641 (A) shows similar protein distribution across tissues to independent antibody HPA014147 (B).
Antibody #2 product nr: HPA014147
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human prostate shows strong granular cytoplasmic positivity in glandular cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex using Anti-CYB5R1 antibody HPA010641.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney using Anti-CYB5R1 antibody HPA010641.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis using Anti-CYB5R1 antibody HPA010641.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human pancreas using Anti-CYB5R1 antibody HPA010641.
Sample type: HUMAN