HPA042037

antibody from Atlas Antibodies

Targeting: TMC5 FLJ13593

Antibody data

Submit

Validation data

Product number: HPA042037 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA042037, RRID:AB_10804126
Product name: Anti-TMC5
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: STWREPDYSDAENGHDYGSSETPKMTRGVLSRTSS IQPSFRHRSDDPVGSLWGENDYPEGIEMASMEMAN SYGHSLPGAPGSGYVNPAYVGESGPVH
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

TMC5 protein structure - HPA042037 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex, colon, duodenum and lymph node using Anti-TMC5 antibody HPA042037 (A) shows similar protein distribution across tissues to independent antibody HPA040810 (B).
Antibody #2 product nr: HPA040810
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human small intestine shows strong membranous positivity in glandular cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lymph node using Anti-TMC5 antibody HPA042037.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon using Anti-TMC5 antibody HPA042037.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human duodenum using Anti-TMC5 antibody HPA042037.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex using Anti-TMC5 antibody HPA042037.
Sample type: HUMAN