HPA029039

antibody from Atlas Antibodies

Targeting: CARMIL1 CARMIL, dJ501N12.1, FLJ20048, LRRC16, LRRC16A

Antibody data

Submit

Validation data

Product number: HPA029039 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA029039, RRID:AB_10611382
Product name: Anti-CARMIL1
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: RSDSKSSPQAGRRYGVQVMGSGLLAEMKAKQEKRA ACAQKKLGNDAVSQDSSSPALSSVERSDGGGAVPK LHPGLPENRFGLGTPEKNTKAEPKAEA
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

CARMIL1 protein structure - HPA029039 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human colon, kidney, lymph node and testis using Anti-CARMIL1 antibody HPA029039 (A) shows similar protein distribution across tissues to independent antibody HPA029038 (B).
Antibody #2 product nr: HPA029038
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney using Anti-CARMIL1 antibody HPA029039.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon using Anti-CARMIL1 antibody HPA029039.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis using Anti-CARMIL1 antibody HPA029039.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lymph node using Anti-CARMIL1 antibody HPA029039.
Sample type: HUMAN