Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN311296 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-AT Rich Interactive Domain 3C (BRIGHT-Like) (ARID3C) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ARID3C antibody: synthetic peptide directed towards the C terminal of human ARID3C
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Canine
- Host
- Rabbit
- Antigen sequence
MGPMDPPRPCMPPSFLPRGKVPLREERLDGPLNLA
GSGIS SINMALEING- Epitope
- C-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references ARID proteins: a diverse family of DNA binding proteins implicated in the control of cell growth, differentiation, and development.
Wilsker D, Patsialou A, Dallas PB, Moran E
Cell growth & differentiation : the molecular biology journal of the American Association for Cancer Research 2002 Mar;13(3):95-106
Cell growth & differentiation : the molecular biology journal of the American Association for Cancer Research 2002 Mar;13(3):95-106
No comments: Submit comment
No validations: Submit validation data