Antibody data
- Antibody Data
- Antigen structure
- References [11]
- Comments [0]
- Validations
- Immunocytochemistry [1]
- Immunohistochemistry [9]
Submit
Validation data
Reference
Comment
Report error
- Product number
- AMAb90655 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#AMAb90655, RRID:AB_2665621
- Product name
- Anti-RBM3
- Antibody type
- Monoclonal
- Reactivity
- Human
- Host
- Mouse
- Conjugate
- Unconjugated
- Antigen sequence
DEQALEDHFSSFGPISEVVVVKDRETQRSRGFGFI
TFTNPEHASVAMRAMNGESLDGRQIRVDHAGKSAR
GTRGGGFGAHGRGRSYSRGGGDQGYGSGRYYDSRP
GGYGYGYGRSRDYNGRNQGGYDRYSGGNY- Isotype
- IgG
- Antibody clone number
- CL0296
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Low RBM3 protein expression correlates with clinical stage, prognostic classification and increased risk of treatment failure in testicular non-seminomatous germ cell cancer.
Evaluation of RNA-binding motif protein 3 expression in urothelial carcinoma of the bladder: an immunohistochemical study.
Evaluating real-time immunohistochemistry on multiple tissue samples, multiple targets and multiple antibody labeling methods.
Decreased expression of RNA-binding motif protein 3 correlates with tumour progression and poor prognosis in urothelial bladder cancer.
Evaluating real-time immunohistochemistry on multiple tissue samples, multiple targets and multiple antibody labeling methods
High MCM3 expression is an independent biomarker of poor prognosis and correlates with reduced RBM3 expression in a prospective cohort of malignant melanoma.
High RBM3 expression in prostate cancer independently predicts a reduced risk of biochemical recurrence and disease progression.
Low RBM3 protein expression correlates with tumour progression and poor prognosis in malignant melanoma: an analysis of 215 cases from the Malmö Diet and Cancer Study.
High nuclear RBM3 expression is associated with an improved prognosis in colorectal cancer.
RBM3-regulated genes promote DNA integrity and affect clinical outcome in epithelial ovarian cancer.
Expression of the RNA-binding protein RBM3 is associated with a favourable prognosis and cisplatin sensitivity in epithelial ovarian cancer.
Olofsson SE, Nodin B, Gaber A, Eberhard J, Uhlén M, Jirström K, Jerkeman M
PloS one 2015;10(3):e0121300
PloS one 2015;10(3):e0121300
Evaluation of RNA-binding motif protein 3 expression in urothelial carcinoma of the bladder: an immunohistochemical study.
Florianova L, Xu B, Traboulsi S, Elmansi H, Tanguay S, Aprikian A, Kassouf W, Brimo F
World journal of surgical oncology 2015 Nov 14;13:317
World journal of surgical oncology 2015 Nov 14;13:317
Evaluating real-time immunohistochemistry on multiple tissue samples, multiple targets and multiple antibody labeling methods.
Dubois L, Andersson K, Asplund A, Björkelund H
BMC research notes 2013 Dec 18;6:542
BMC research notes 2013 Dec 18;6:542
Decreased expression of RNA-binding motif protein 3 correlates with tumour progression and poor prognosis in urothelial bladder cancer.
Boman K, Segersten U, Ahlgren G, Eberhard J, Uhlén M, Jirström K, Malmström PU
BMC urology 2013 Apr 8;13:17
BMC urology 2013 Apr 8;13:17
Evaluating real-time immunohistochemistry on multiple tissue samples, multiple targets and multiple antibody labeling methods
Dubois L, Andersson K, Asplund A, Björkelund H
BMC Research Notes 2013 ;6(1):542
BMC Research Notes 2013 ;6(1):542
High MCM3 expression is an independent biomarker of poor prognosis and correlates with reduced RBM3 expression in a prospective cohort of malignant melanoma.
Nodin B, Fridberg M, Jonsson L, Bergman J, Uhlén M, Jirström K
Diagnostic pathology 2012 Jul 17;7:82
Diagnostic pathology 2012 Jul 17;7:82
High RBM3 expression in prostate cancer independently predicts a reduced risk of biochemical recurrence and disease progression.
Jonsson L, Gaber A, Ulmert D, Uhlén M, Bjartell A, Jirström K
Diagnostic pathology 2011 Sep 28;6:91
Diagnostic pathology 2011 Sep 28;6:91
Low RBM3 protein expression correlates with tumour progression and poor prognosis in malignant melanoma: an analysis of 215 cases from the Malmö Diet and Cancer Study.
Jonsson L, Bergman J, Nodin B, Manjer J, Pontén F, Uhlén M, Jirström K
Journal of translational medicine 2011 Jul 21;9:114
Journal of translational medicine 2011 Jul 21;9:114
High nuclear RBM3 expression is associated with an improved prognosis in colorectal cancer.
Hjelm B, Brennan DJ, Zendehrokh N, Eberhard J, Nodin B, Gaber A, Pontén F, Johannesson H, Smaragdi K, Frantz C, Hober S, Johnson LB, Påhlman S, Jirström K, Uhlen M
Proteomics. Clinical applications 2011 Dec;5(11-12):624-35
Proteomics. Clinical applications 2011 Dec;5(11-12):624-35
RBM3-regulated genes promote DNA integrity and affect clinical outcome in epithelial ovarian cancer.
Ehlén Å, Nodin B, Rexhepaj E, Brändstedt J, Uhlén M, Alvarado-Kristensson M, Pontén F, Brennan DJ, Jirström K
Translational oncology 2011 Aug;4(4):212-21
Translational oncology 2011 Aug;4(4):212-21
Expression of the RNA-binding protein RBM3 is associated with a favourable prognosis and cisplatin sensitivity in epithelial ovarian cancer.
Ehlén A, Brennan DJ, Nodin B, O'Connor DP, Eberhard J, Alvarado-Kristensson M, Jeffrey IB, Manjer J, Brändstedt J, Uhlén M, Pontén F, Jirström K
Journal of translational medicine 2010 Aug 20;8:78
Journal of translational medicine 2010 Aug 20;8:78
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescence staining of U-2 OS cells using the anti-RBM3 monoclonal antibody, showing specific staining in the nucleoplasm in green. Microtubule- and nuclear probes are visualized in red and blue, respectively (where available).
- Sample type
- HUMAN
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human tonsil and liver tissues using AMAb90655 antibody. Corresponding RBM3 RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human breast cancer shows moderate nuclear positivity in tumour cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human colorectal tumour shows moderate nuclear positivity in cancer cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human prostate tumour shows moderate to strong nuclear positivity in tumour cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human tonsil shows moderate nuclear positivity in lymphoid cells, mainly in germinal centra.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human rectum shows moderate nuclear positivity in glandular cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human breast cancer shows moderate nuclear positivity in tumor cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human colorectal cancer shows weak to moderate nuclear positivity in a subset of tumor cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human liver shows no positivity in hepatocytes as expected.