Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Western blot [2]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00000054-D01P - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00000054-D01P, RRID:AB_1672895
- Product name
- ACP5 purified MaxPab rabbit polyclonal antibody (D01P)
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against a full-length human ACP5 protein.
- Antigen sequence
MDMWTALLILQALLLPSLADGATPALRFVAVGDWG
GVPNAPFHTAREMANAKEIARTVQILGADFILSLG
DNFYFTGVQDINDKRFQETFEDVFSDRSLRKVPWY
VLAGNHDHLGNVSAQIAYSKISKRWNFPSPFYRLH
FKIPQTNVSVAIFMLDTVTLCGNSDDFLSQQPERP
RDVKLARTQLSWLKKQLAAAREDYVLVAGHYPVWS
IAEHGPTHCLVKQLRPLLATYGVTAYLCGHDHNLQ
YLQDENGVGYVLSGAGNFMDPSKRHQRKVPNGYLR
FHYGTEDSLGGFAYVEISSKEMTVTYIEASGKSLF
KTRLPRRARP- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Comparison of the skeletal effects induced by daily administration of PTHrP (1-36) and PTHrP (107-139) to ovariectomized mice.
The C-terminal fragment of parathyroid hormone-related peptide promotes bone formation in diabetic mice with low-turnover osteopaenia.
Role of the N- and C-terminal fragments of parathyroid-hormone-related protein as putative therapies to improve bone regeneration under high glucocorticoid treatment.
de Castro LF, Lozano D, Portal-Núñez S, Maycas M, De la Fuente M, Caeiro JR, Esbrit P
Journal of cellular physiology 2012 Apr;227(4):1752-60
Journal of cellular physiology 2012 Apr;227(4):1752-60
The C-terminal fragment of parathyroid hormone-related peptide promotes bone formation in diabetic mice with low-turnover osteopaenia.
Lozano D, Fernández-de-Castro L, Portal-Núñez S, López-Herradón A, Dapía S, Gómez-Barrena E, Esbrit P
British journal of pharmacology 2011 Mar;162(6):1424-38
British journal of pharmacology 2011 Mar;162(6):1424-38
Role of the N- and C-terminal fragments of parathyroid-hormone-related protein as putative therapies to improve bone regeneration under high glucocorticoid treatment.
de Castro LF, Lozano D, Dapía S, Portal-Núñez S, Caeiro JR, Gómez-Barrena E, Esbrit P
Tissue engineering. Part A 2010 Apr;16(4):1157-68
Tissue engineering. Part A 2010 Apr;16(4):1157-68
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of ACP5 expression in transfected 293T cell line (H00000054-T01) by ACP5 MaxPab polyclonal antibody.Lane 1: ACP5 transfected lysate(36.60 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- ACP5 MaxPab rabbit polyclonal antibody. Western Blot analysis of ACP5 expression in human liver.