Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN406630 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Matrilin 2 (MATN2) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-MATN2 antibody: synthetic peptide directed towards the middle region of human MATN2
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine
- Host
- Rabbit
- Antigen sequence
AVGVGKAIEEELQEIASEPTNKHLFYAEDFSTMDE
ISEKL KKGICEALED- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Fibrillin-2, tenascin-C, matrilin-2, and matrilin-4 are strongly expressed in the epithelium of human granular and lattice type I corneal dystrophies.
DeltaNp63/BMP-7-dependent expression of matrilin-2 is involved in keratinocyte migration in response to wounding.
Szalai E, Felszeghy S, Hegyi Z, Módis L Jr, Berta A, Kaarniranta K
Molecular vision 2012;18:1927-36
Molecular vision 2012;18:1927-36
DeltaNp63/BMP-7-dependent expression of matrilin-2 is involved in keratinocyte migration in response to wounding.
Ichikawa T, Suenaga Y, Koda T, Ozaki T, Nakagawara A
Biochemical and biophysical research communications 2008 May 16;369(4):994-1000
Biochemical and biophysical research communications 2008 May 16;369(4):994-1000
No comments: Submit comment
No validations: Submit validation data