Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN406680 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Ubiquitin Specific Peptidase 22 (USP22) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-USP22 antibody: synthetic peptide directed towards the N terminal of human USP22
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
RLHSCLYCVFFGCFTKKHIHEHAKAKRHNLAIDLM
YGGIY CFLCQDYIYD- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references The putative cancer stem cell marker USP22 is a subunit of the human SAGA complex required for activated transcription and cell-cycle progression.
Zhang XY, Varthi M, Sykes SM, Phillips C, Warzecha C, Zhu W, Wyce A, Thorne AW, Berger SL, McMahon SB
Molecular cell 2008 Jan 18;29(1):102-11
Molecular cell 2008 Jan 18;29(1):102-11
No comments: Submit comment
No validations: Submit validation data