Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunocytochemistry [1]
- Immunoprecipitation [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00003033-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00003033-M01, RRID:AB_530074
- Product name
- HADHSC monoclonal antibody (M01), clone 4B5
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant HADHSC.
- Antigen sequence
GKHPVSCKDTPGFIVNRLLVPYLMEAIRLYERGDA
SKEDIDTAMKLGAGYPMGPFELLDYVGLDTTKFIV
DGWHEMDAENPLHQPSPSLNKLVAENKFGKKTGEG
FYKYK- Isotype
- IgG
- Antibody clone number
- 4B5
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Changes in peak fat oxidation in response to different doses of endurance training.
Independent effects of endurance training and weight loss on peak fat oxidation in moderately overweight men: a randomized controlled trial.
BCAT1 promotes cell proliferation through amino acid catabolism in gliomas carrying wild-type IDH1.
Rosenkilde M, Reichkendler MH, Auerbach P, Bonne TC, Sjödin A, Ploug T, Stallknecht BM
Scandinavian journal of medicine & science in sports 2015 Feb;25(1):41-52
Scandinavian journal of medicine & science in sports 2015 Feb;25(1):41-52
Independent effects of endurance training and weight loss on peak fat oxidation in moderately overweight men: a randomized controlled trial.
Nordby P, Rosenkilde M, Ploug T, Westh K, Feigh M, Nielsen NB, Helge JW, Stallknecht B
Journal of applied physiology (Bethesda, Md. : 1985) 2015 Apr 1;118(7):803-10
Journal of applied physiology (Bethesda, Md. : 1985) 2015 Apr 1;118(7):803-10
BCAT1 promotes cell proliferation through amino acid catabolism in gliomas carrying wild-type IDH1.
Tönjes M, Barbus S, Park YJ, Wang W, Schlotter M, Lindroth AM, Pleier SV, Bai AHC, Karra D, Piro RM, Felsberg J, Addington A, Lemke D, Weibrecht I, Hovestadt V, Rolli CG, Campos B, Turcan S, Sturm D, Witt H, Chan TA, Herold-Mende C, Kemkemer R, König R, Schmidt K, Hull WE, Pfister SM, Jugold M, Hutson SM, Plass C, Okun JG, Reifenberger G, Lichter P, Radlwimmer B
Nature medicine 2013 Jul;19(7):901-908
Nature medicine 2013 Jul;19(7):901-908
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- HADHSC monoclonal antibody (M01), clone 4B5 Western Blot analysis of HADHSC expression in HepG2 ( Cat # L019V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of HADH expression in transfected 293T cell line by HADHSC monoclonal antibody (M01), clone 4B5.Lane 1: HADH transfected lysate(34.3 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged HADHSC is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to HADHSC on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoprecipitation of HADH transfected lysate using anti-HADH monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with HADH MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to HADHSC on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol