Antibody data
- Antibody Data
- Antigen structure
- References [4]
- Comments [0]
- Validations
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00004891-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00004891-M01, RRID:AB_464397
- Product name
- SLC11A2 monoclonal antibody (M01), clone 4C6
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant SLC11A2.
- Antigen sequence
MVLGPEQKMSDDSVSGDHGESASLGNINPAYSNPS
LSQSPGDSEEYFATYFNEKISIPEEEYSCF- Isotype
- IgG
- Antibody clone number
- 4C6
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Discovery and characterization of a novel non-competitive inhibitor of the divalent metal transporter DMT1/SLC11A2.
Development and Validation of a Fast and Homogeneous Cell-Based Fluorescence Screening Assay for Divalent Metal Transporter 1 (DMT1/SLC11A2) Using the FLIPR Tetra.
Divalent metal transporter 1 (DMT1) regulation by Ndfip1 prevents metal toxicity in human neurons.
Regulation of the divalent metal ion transporter DMT1 and iron homeostasis by a ubiquitin-dependent mechanism involving Ndfips and WWP2.
Montalbetti N, Simonin A, Simonin C, Awale M, Reymond JL, Hediger MA
Biochemical pharmacology 2015 Aug 1;96(3):216-24
Biochemical pharmacology 2015 Aug 1;96(3):216-24
Development and Validation of a Fast and Homogeneous Cell-Based Fluorescence Screening Assay for Divalent Metal Transporter 1 (DMT1/SLC11A2) Using the FLIPR Tetra.
Montalbetti N, Simonin A, Dalghi MG, Kovacs G, Hediger MA
Journal of biomolecular screening 2014 Jul;19(6):900-8
Journal of biomolecular screening 2014 Jul;19(6):900-8
Divalent metal transporter 1 (DMT1) regulation by Ndfip1 prevents metal toxicity in human neurons.
Howitt J, Putz U, Lackovic J, Doan A, Dorstyn L, Cheng H, Yang B, Chan-Ling T, Silke J, Kumar S, Tan SS
Proceedings of the National Academy of Sciences of the United States of America 2009 Sep 8;106(36):15489-94
Proceedings of the National Academy of Sciences of the United States of America 2009 Sep 8;106(36):15489-94
Regulation of the divalent metal ion transporter DMT1 and iron homeostasis by a ubiquitin-dependent mechanism involving Ndfips and WWP2.
Foot NJ, Dalton HE, Shearwin-Whyatt LM, Dorstyn L, Tan SS, Yang B, Kumar S
Blood 2008 Nov 15;112(10):4268-75
Blood 2008 Nov 15;112(10):4268-75
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged SLC11A2 is 0.03 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to SLC11A2 on formalin-fixed paraffin-embedded human endometrium cancer. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol