HPA053510

antibody from Atlas Antibodies

Targeting: ZC3H14 FLJ11806, NY-REN-37, UKp68

Antibody data

Submit

Validation data

Product number: HPA053510 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA053510, RRID:AB_2682174
Product name: Anti-ZC3H14
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: LILKAISEAQESVTKTTNYSTVPQKQTLPVAPRTR TSQEELLAEVVQGQSRTPRISPPIKEEETKGDSVE KNQGTQQRQLLSRLQIDPVMA
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

ZC3H14 protein structure - HPA053510 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human testis and skeletal muscle tissues using Anti-ZC3H14 antibody. Corresponding ZC3H14 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human colon, kidney, liver and testis using Anti-ZC3H14 antibody HPA053510 (A) shows similar protein distribution across tissues to independent antibody HPA049798 (B).
Antibody #2 product nr: HPA049798
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human bronchus shows strong nuclear positivity in respiratory epithelial cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skeletal muscle shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney using Anti-ZC3H14 antibody HPA053510.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon using Anti-ZC3H14 antibody HPA053510.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver using Anti-ZC3H14 antibody HPA053510.
Sample type: HUMAN