HPA038666

antibody from Atlas Antibodies

Targeting: BIN2 BRAP-1

Antibody data

Submit

Validation data

Product number: HPA038666 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA038666, RRID:AB_2676139
Product name: Anti-BIN2
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: EKPVRTPEAKENENIHNQNPEELCTSPTLMTSQVA SEPGEAKKMEDKEKDNKLISADSSEGQDQLQVSMV PENNNLTAPEPQEEVSTSENPQL
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

BIN2 protein structure - HPA038666 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human bone marrow and pancreas tissues using Anti-BIN2 antibody. Corresponding BIN2 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human bone marrow, liver, lymph node and pancreas using Anti-BIN2 antibody HPA038666 (A) shows similar protein distribution across tissues to independent antibody HPA038667 (B).
Antibody #2 product nr: HPA038667
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human spleen shows strong cytoplasmic positivity in cells in red pulp.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human bone marrow shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human pancreas shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lymph node using Anti-BIN2 antibody HPA038666.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver using Anti-BIN2 antibody HPA038666.
Sample type: HUMAN