HPA056756

antibody from Atlas Antibodies

Targeting: PPP1R10 CAT53, FB19, p99, PNUTS

Antibody data

Submit

Validation data

Product number: HPA056756 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA056756, RRID:AB_2683227
Product name: Anti-PPP1R10
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: LMDTASLEPGALDAKPVESPGDPNQLTRKGRKRKS VTWPEEGKLREYFYFELDETERVNVNKIKDFGEAA KREILSDRHAFETARRLSHDNMEEKVPWV
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

PPP1R10 protein structure - HPA056756 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human colon, kidney, skin and testis using Anti-PPP1R10 antibody HPA056756 (A) shows similar protein distribution across tissues to independent antibody HPA047248 (B).
Antibody #2 product nr: HPA047248
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex shows strong nuclear positivity in neuronal cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis using Anti-PPP1R10 antibody HPA056756.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney using Anti-PPP1R10 antibody HPA056756.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skin using Anti-PPP1R10 antibody HPA056756.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon using Anti-PPP1R10 antibody HPA056756.
Sample type: HUMAN