Explore
Validate
Learn
ImmunocytochemistryAntibody data
- Antibody Data
- Antigen structure
- References [4]
- Comments [0]
- Validations
- Immunocytochemistry [1]
- Immunohistochemistry [3]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA038002 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA038002, RRID:AB_10672401
- Product name
- Anti-METTL14
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
RSWNMDSRLQEIRERQKLRRQLLAQQLGAESADSI
GAVLNSKDEQREIAETRETCRASYDTSAPNAKRKY
LDEGETDEDKMEEYKDELEMQQDEE- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Dynamic m(6)A mRNA methylation directs translational control of heat shock response.
N(6)-methyladenosine-dependent RNA structural switches regulate RNA-protein interactions.
N6-methyladenosine modification destabilizes developmental regulators in embryonic stem cells
A METTL3-METTL14 complex mediates mammalian nuclear RNA N6-adenosine methylation.
Zhou J, Wan J, Gao X, Zhang X, Jaffrey SR, Qian SB
Nature 2015 Oct 22;526(7574):591-4
Nature 2015 Oct 22;526(7574):591-4
N(6)-methyladenosine-dependent RNA structural switches regulate RNA-protein interactions.
Liu N, Dai Q, Zheng G, He C, Parisien M, Pan T
Nature 2015 Feb 26;518(7540):560-4
Nature 2015 Feb 26;518(7540):560-4
N6-methyladenosine modification destabilizes developmental regulators in embryonic stem cells
Wang Y, Li Y, Toth J, Petroski M, Zhang Z, Zhao J
Nature Cell Biology 2014 January;16(2):191-198
Nature Cell Biology 2014 January;16(2):191-198
A METTL3-METTL14 complex mediates mammalian nuclear RNA N6-adenosine methylation.
Liu J, Yue Y, Han D, Wang X, Fu Y, Zhang L, Jia G, Yu M, Lu Z, Deng X, Dai Q, Chen W, He C
Nature chemical biology 2014 Feb;10(2):93-5
Nature chemical biology 2014 Feb;10(2):93-5
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human fallopian tube shows strong nuclear positivity in glandular cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human kidney shows moderate to strong nuclear positivity in glomeruli and cells in tubules.
- Sample type
- HUMAN
