Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
- Immunohistochemistry [11]
Submit
Validation data
Reference
Comment
Report error
- Product number
- AMAb91275 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#AMAb91275, RRID:AB_2665877
- Product name
- Anti-METTL14
- Antibody type
- Monoclonal
- Reactivity
- Human
- Host
- Mouse
- Conjugate
- Unconjugated
- Antigen sequence
RSWNMDSRLQEIRERQKLRRQLLAQQLGAESADSI
GAVLNSKDEQREIAETRETCRASYDTSAPNAKRKY
LDEGETDEDKMEEYKDELEMQQDEE- Isotype
- IgG
- Antibody clone number
- CL4252
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Western blot analysis in human cell line A-431.
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescence staining of RH-30 cells using the Anti-METTL14 monoclonal antibody, showing specific staining in the nucleoplasm in green. Microtubule- and nuclear probes are visualized in red and blue, respectively (where available).
- Sample type
- HUMAN
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human testis and skeletal muscle tissues using AMAb91275 antibody. Corresponding METTL14 RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis shows strong nuclear positivity in cells in seminiferous tubules.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human endometrium shows strong nuclear immunoreactivity in glandular cells and in stroma.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human prostate shows strong nuclear positivity in glandular cells and in smooth muscle cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cervix shows strong nuclear immunoreactivity in squamous epithelium and connective tissue cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex shows moderate nuclear positivity in neurons.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human duodenum shows strong nuclear immunoreactivity in glandular cells and in the connective tissue.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human endometrium shows strong nuclear positivity in glandular and stromal cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human duodenum shows strong nuclear positivity in glandular cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human skeletal muscle shows only weak nuclear positivity in striated muscle fibers.