AMAb91275

antibody from Atlas Antibodies

Targeting: METTL14 KIAA1627

Western blot (Supportive data in Antibodypedia)

Immunocytochemistry (Supportive data in Antibodypedia)

Immunohistochemistry (Enhanced validation)

Antibody Data

Product number

AMAb91275

Provider

Atlas Antibodies

Proper citation

Atlas Antibodies Cat#AMAb91275, RRID:AB_2665877

Product name

Anti-METTL14

Antibody type

Monoclonal

Reactivity

Human

Host

Mouse

Conjugate

Unconjugated

Antigen sequence

RSWNMDSRLQEIRERQKLRRQLLAQQLGAESADSI
GAVLNSKDEQREIAETRETCRASYDTSAPNAKRKY
LDEGETDEDKMEEYKDELEMQQDEE


Isotype

IgG

Antibody clone number

CL4252

Vial size

100 µl

Storage

Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Western blot

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Western blot analysis in human cell line A-431.

Immunocytochemistry

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunofluorescence staining of RH-30 cells using the Anti-METTL14 monoclonal antibody, showing specific staining in the nucleoplasm in green. Microtubule- and nuclear probes are visualized in red and blue, respectively (where available).

Sample type

HUMAN

Immunohistochemistry

Enhanced validation

Submitted by

Atlas Antibodies (provider)

Enhanced method

Orthogonal validation

Main image

Experimental details

Immunohistochemistry analysis in human testis and skeletal muscle tissues using AMAb91275 antibody. Corresponding METTL14 RNA-seq data are presented for the same tissues.

Sample type

HUMAN

Orthogonal method

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Show more

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human testis shows strong nuclear positivity in cells in seminiferous tubules.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human endometrium shows strong nuclear immunoreactivity in glandular cells and in stroma.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human prostate shows strong nuclear positivity in glandular cells and in smooth muscle cells.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human cervix shows strong nuclear immunoreactivity in squamous epithelium and connective tissue cells.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human cerebral cortex shows moderate nuclear positivity in neurons.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human duodenum shows strong nuclear immunoreactivity in glandular cells and in the connective tissue.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human endometrium shows strong nuclear positivity in glandular and stromal cells.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human duodenum shows strong nuclear positivity in glandular cells.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human skeletal muscle shows only weak nuclear positivity in striated muscle fibers.