Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00009871-M04 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00009871-M04, RRID:AB_530196
- Product name
- SEC24D monoclonal antibody (M04), clone 1A8
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant SEC24D.
- Antigen sequence
SPPELIQGIFNVPSFAHINTDMTLLPEVGNPYSQQ
LRMIMGIIQQKRPYSMKLTIVKQREQPEMVFRQFL
VEDKGLYGGSSYVDFLCCVHKEICQLLN- Isotype
- IgG
- Antibody clone number
- 1A8
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Hsp70 promotes epithelial sodium channel functional expression by increasing its association with coat complex II and its exit from endoplasmic reticulum.
Role of Rab1b in COPII dynamics and function.
New class of microRNA targets containing simultaneous 5'-UTR and 3'-UTR interaction sites.
Chanoux RA, Robay A, Shubin CB, Kebler C, Suaud L, Rubenstein RC
The Journal of biological chemistry 2012 Jun 1;287(23):19255-65
The Journal of biological chemistry 2012 Jun 1;287(23):19255-65
Role of Rab1b in COPII dynamics and function.
Slavin I, GarcĂa IA, Monetta P, Martinez H, Romero N, Alvarez C
European journal of cell biology 2011 Apr;90(4):301-11
European journal of cell biology 2011 Apr;90(4):301-11
New class of microRNA targets containing simultaneous 5'-UTR and 3'-UTR interaction sites.
Lee I, Ajay SS, Yook JI, Kim HS, Hong SH, Kim NH, Dhanasekaran SM, Chinnaiyan AM, Athey BD
Genome research 2009 Jul;19(7):1175-83
Genome research 2009 Jul;19(7):1175-83
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- SEC24D monoclonal antibody (M04), clone 1A8 Western Blot analysis of SEC24D expression in HeLa ( Cat # L013V1 ).