Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00023475-A01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00023475-A01, RRID:AB_463398
- Product name
- QPRT polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant QPRT.
- Antigen sequence
VEVECSSLQEAVQAAEAGADLVLLDNFKPEELHPT
ATVLKAQFPSVAVEASGGITLDNLPQFCGPHIDVI
SMGMLTQAAPALDFSLKLFAKEVAPVPKIH- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Characterization of the kynurenine pathway in human neurons.
Guillemin GJ, Cullen KM, Lim CK, Smythe GA, Garner B, Kapoor V, Takikawa O, Brew BJ
The Journal of neuroscience : the official journal of the Society for Neuroscience 2007 Nov 21;27(47):12884-92
The Journal of neuroscience : the official journal of the Society for Neuroscience 2007 Nov 21;27(47):12884-92
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- QPRT polyclonal antibody (A01), Lot # 060803QCS1 Western Blot analysis of QPRT expression in K-562 ( Cat # L009V1 ).