Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00009542-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00009542-M01, RRID:AB_606684
- Product name
- NRG2 monoclonal antibody (M01), clone 3D2
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant NRG2.
- Antigen sequence
SLKSVQDQAYKAPVVVEGKVQGLVPAGGSSSNSTR
EPPASGRVALVKVLDKWPLRSGGLQREQVISVGSC
VPLERNQRYIFFLEPTEQPLVFKTAFAPLD- Isotype
- IgG
- Antibody clone number
- 3D2
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Activation of ErbB3, EGFR and Erk is essential for growth of human breast cancer cell lines with acquired resistance to fulvestrant.
Frogne T, Benjaminsen RV, Sonne-Hansen K, Sorensen BS, Nexo E, Laenkholm AV, Rasmussen LM, Riese DJ 2nd, de Cremoux P, Stenvang J, Lykkesfeldt AE
Breast cancer research and treatment 2009 Mar;114(2):263-75
Breast cancer research and treatment 2009 Mar;114(2):263-75
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- NRG2 monoclonal antibody (M01), clone 3D2. Western Blot analysis of NRG2 expression in human pancreas.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged NRG2 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
