Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00010424-M04 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00010424-M04, RRID:AB_530172
- Product name
- PGRMC2 monoclonal antibody (M04), clone 3C11
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant PGRMC2.
- Antigen sequence
NGKVFDVTKGSKFYGPAGPYGIFAGRDASRGLATF
CLDKDALRDEYDDLSDLNAVQMESVREWEMQFKEK
YDYVGRLLKPGEEPSEYTDEEDTKDHNKQD- Isotype
- IgG
- Antibody clone number
- 3C11
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Alterations in progesterone receptor membrane component 2 (PGRMC2) in the endometrium of macaques afflicted with advanced endometriosis.
Keator CS, Mah K, Slayden OD
Molecular human reproduction 2012 Jun;18(6):308-19
Molecular human reproduction 2012 Jun;18(6):308-19
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- PGRMC2 monoclonal antibody (M04), clone 3C11. Western Blot analysis of PGRMC2 expression in Raw 264.7(Cat # L024V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged PGRMC2 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to PGRMC2 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 1 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol