Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00004051-A01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00004051-A01, RRID:AB_463569
- Product name
- CYP4F3 polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant CYP4F3.
- Antigen sequence
RIFHPTYIKPVLFAPAAIVPKDKVFYSFLKPWLGD
GLLLSAGEKWSRHRRMLTPAFHFNILKPYMKIFNE
SVNIMHAKWQLLASEGSARLDMFEHISLM- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Immunochemical quantification of cynomolgus CYP2J2, CYP4A and CYP4F enzymes in liver and small intestine.
Comparison of toxicity of benzene metabolite hydroquinone in hematopoietic stem cells derived from murine embryonic yolk sac and adult bone marrow.
Induction of CYP4F3 by benzene metabolites in human white blood cells in vivo in human promyelocytic leukemic cell lines and ex vivo in human blood neutrophils.
Uehara S, Murayama N, Nakanishi Y, Nakamura C, Hashizume T, Zeldin DC, Yamazaki H, Uno Y
Xenobiotica; the fate of foreign compounds in biological systems 2015 Feb;45(2):124-30
Xenobiotica; the fate of foreign compounds in biological systems 2015 Feb;45(2):124-30
Comparison of toxicity of benzene metabolite hydroquinone in hematopoietic stem cells derived from murine embryonic yolk sac and adult bone marrow.
Zhu J, Wang H, Yang S, Guo L, Li Z, Wang W, Wang S, Huang W, Wang L, Yang T, Ma Q, Bi Y
PloS one 2013;8(8):e71153
PloS one 2013;8(8):e71153
Induction of CYP4F3 by benzene metabolites in human white blood cells in vivo in human promyelocytic leukemic cell lines and ex vivo in human blood neutrophils.
Zhao Z, He X, Bi Y, Xia Y, Tao N, Li L, Ma Q
Drug metabolism and disposition: the biological fate of chemicals 2009 Feb;37(2):282-91
Drug metabolism and disposition: the biological fate of chemicals 2009 Feb;37(2):282-91
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- CYP4F3 polyclonal antibody (A01), Lot # UNO2060310QCS1 Western Blot analysis of CYP4F3 expression in NIH/3T3 ( Cat # L018V1 ).
