Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00000199-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00000199-M01, RRID:AB_425294
- Product name
- AIF1 monoclonal antibody (M01), clone 2A2-B6
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant AIF1.
- Antigen sequence
MSQTRDLQGGKAFGLLKAQQEERLDEINKQFLDDP
KYSSDEDLPSKLEGFKEKYMEFDLNGNGDIDIMSL
KRMLEKLGVPKTHLELKKLIGEVSSGSGETFSYPD
FLRMMLGKRSAILKVILMYEEKAREKEKPTGPPAK
KAISELP- Isotype
- IgG
- Antibody clone number
- 2A2-B6
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Allograft inflammatory factor-1/Ionized calcium-binding adapter molecule 1 is specifically expressed by most subpopulations of macrophages and spermatids in testis.
Köhler C
Cell and tissue research 2007 Nov;330(2):291-302
Cell and tissue research 2007 Nov;330(2):291-302
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- AIF1 monoclonal antibody (M01), clone 2A2-B6 Western Blot analysis of AIF1 expression in K-562 ( Cat # L009V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged AIF1 is 0.03 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol