HPA037930

antibody from Atlas Antibodies

Targeting: TNKS1BP1 FLJ45975, KIAA1741, TAB182

Antibody data

Submit

Validation data

Product number: HPA037930 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA037930, RRID:AB_2675745
Product name: Anti-TNKS1BP1
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: EVLASPDRLWGSRLTFNHDGSSRYGPRTYGTTTAP RDEDGSTLFRGWSQEGPVKSPAECREEHSKTPEER SLPSDLAFNGDLAKAASSELPAD
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

TNKS1BP1 protein structure - HPA037930 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human skin and skeletal muscle tissues using Anti-TNKS1BP1 antibody. Corresponding TNKS1BP1 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human kidney, prostate, skeletal muscle and skin using Anti-TNKS1BP1 antibody HPA037930 (A) shows similar protein distribution across tissues to independent antibody HPA037929 (B).
Antibody #2 product nr: HPA037929
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human prostate shows distinct cytoplasmic and membranous positivity in glandular cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skin shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skeletal muscle shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney using Anti-TNKS1BP1 antibody HPA037930.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human prostate using Anti-TNKS1BP1 antibody HPA037930.
Sample type: HUMAN