HPA034830

antibody from Atlas Antibodies

Targeting: SF3B6 CGI-110, Ht006, P14, SAP14a, SF3B14a

Antibody data

Submit

Validation data

Product number: HPA034830 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA034830, RRID:AB_10669680
Product name: Anti-SF3B6
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: MAMQAAKRANIRLPPEVNRILYIRNLPYKITAEEM YDIFGKYGPIRQIRVGNTPETRGTAYVV
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

SF3B6 protein structure - HPA034830 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human breast and skeletal muscle tissues using Anti-SF3B6 antibody. Corresponding SF3B6 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human breast, kidney, lymph node and skeletal muscle using Anti-SF3B6 antibody HPA034830 (A) shows similar protein distribution across tissues to independent antibody HPA034829 (B).
Antibody #2 product nr: HPA034829
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human placenta shows strong nuclear positivity in decidual cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human breast shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skeletal muscle shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney using Anti-SF3B6 antibody HPA034830.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lymph node using Anti-SF3B6 antibody HPA034830.
Sample type: HUMAN