Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- Immunocytochemistry [1]
- Immunoprecipitation [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00007453-M02 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00007453-M02, RRID:AB_607288
- Product name
- WARS monoclonal antibody (M02), clone 3A12
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant WARS.
- Antigen sequence
YKAAAGEDYKADCPPGNPAPTSNHGPDATEAEEDF
VDPWTVQTSSAKGIDYDKLIVRFGSSKIDKELINR
IERATGQRPHHFLRRGIFFSHRDMNQVLDA- Isotype
- IgG
- Antibody clone number
- 3A12
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- WARS monoclonal antibody (M02), clone 3A12 Western Blot analysis of WARS expression in HeLa ( Cat # L013V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of WARS expression in transfected 293T cell line by WARS monoclonal antibody (M02), clone 3A12.Lane 1: WARS transfected lysate(53.2 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to WARS on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoprecipitation of WARS transfected lysate using anti-WARS monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with WARS MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol
