Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00001192-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00001192-M01, RRID:AB_1111735
- Product name
- CLIC1 monoclonal antibody (M01), clone 2D4
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full-length recombinant CLIC1.
- Antigen sequence
MAEEQPQVELFVKAGSDGAKIGNCPFSQRLFMVLW
LKGVTFNVTTVDTKRRTETVQKLCPGGQLPFLLYG
TEVHTDTNKIEEFLEAVLCPPRYPKLAALNPESNT
AGLDIFAKFSAYIKNSSPALNDNLEKGLLKALKVL
DNYLTSPLPEEVDETSAEDEGVSQRKFLDGNELTL
ADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYL
SNAYAREEFASTCPDDEEIELAYEQVAKALK- Isotype
- IgG
- Antibody clone number
- 2D4
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Redox proteomics reveal stress responsive proteins linking peroxiredoxin-1 status in glioma to chemosensitivity and oxidative stress.
Proteomic differences between hepatocellular carcinoma and nontumorous liver tissue investigated by a combined gel-based and label-free quantitative proteomics study.
Poschmann G, Grzendowski M, Stefanski A, Bruns E, Meyer HE, Stühler K
Biochimica et biophysica acta 2015 Jun;1854(6):624-31
Biochimica et biophysica acta 2015 Jun;1854(6):624-31
Proteomic differences between hepatocellular carcinoma and nontumorous liver tissue investigated by a combined gel-based and label-free quantitative proteomics study.
Megger DA, Bracht T, Kohl M, Ahrens M, Naboulsi W, Weber F, Hoffmann AC, Stephan C, Kuhlmann K, Eisenacher M, Schlaak JF, Baba HA, Meyer HE, Sitek B
Molecular & cellular proteomics : MCP 2013 Jul;12(7):2006-20
Molecular & cellular proteomics : MCP 2013 Jul;12(7):2006-20
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- CLIC1 monoclonal antibody (M01), clone 2D4 Western Blot analysis of CLIC1 expression in HL-60 ( Cat # L014V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged CLIC1 is 1 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to CLIC1 on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to CLIC1 on formalin-fixed paraffin-embedded human colon tissue. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol
