HPA044094

antibody from Atlas Antibodies

Targeting: GLYAT ACGNAT, GAT

Antibody data

Submit

Validation data

Product number: HPA044094 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA044094, RRID:AB_2678807
Product name: Anti-GLYAT
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: YTNTYQIYSKDPQNCQEFLGSPELINWKQHLQIQS SQPSLNEAIQNLAAIKSFKVKQTQRILYMAAETAK ELT
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

GLYAT protein structure - HPA044094 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human kidney and duodenum tissues using Anti-GLYAT antibody. Corresponding GLYAT RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human colon, kidney, liver and skeletal muscle using Anti-GLYAT antibody HPA044094 (A) shows similar protein distribution across tissues to independent antibody HPA040251 (B).
Antibody #2 product nr: HPA040251
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human duodenum shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skeletal muscle using Anti-GLYAT antibody HPA044094.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon using Anti-GLYAT antibody HPA044094.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver using Anti-GLYAT antibody HPA044094.
Sample type: HUMAN