Explore
Validate
LearnAntibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00005959-A01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00005959-A01, RRID:AB_529891
- Product name
- RDH5 polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant RDH5.
- Antigen sequence
GLEAFSDSLRRDVAHFGIRVSIVEPGFFRTPVTNL
ESLEKTLQACWARLPPATQAHYGGAFLTKYLKMQQ
RIMNLICDPDLTKVSRCLEHALTARHPRTR- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references A low carbohydrate, high protein diet suppresses intratumoral androgen synthesis and slows castration-resistant prostate tumor growth in mice.
Insulin increases de novo steroidogenesis in prostate cancer cells.
Androgen levels increase by intratumoral de novo steroidogenesis during progression of castration-resistant prostate cancer.
Fokidis HB, Yieng Chin M, Ho VW, Adomat HH, Soma KK, Fazli L, Nip KM, Cox M, Krystal G, Zoubeidi A, Tomlinson Guns ES
The Journal of steroid biochemistry and molecular biology 2015 Jun;150:35-45
The Journal of steroid biochemistry and molecular biology 2015 Jun;150:35-45
Insulin increases de novo steroidogenesis in prostate cancer cells.
Lubik AA, Gunter JH, Hendy SC, Locke JA, Adomat HH, Thompson V, Herington A, Gleave ME, Pollak M, Nelson CC
Cancer research 2011 Sep 1;71(17):5754-64
Cancer research 2011 Sep 1;71(17):5754-64
Androgen levels increase by intratumoral de novo steroidogenesis during progression of castration-resistant prostate cancer.
Locke JA, Guns ES, Lubik AA, Adomat HH, Hendy SC, Wood CA, Ettinger SL, Gleave ME, Nelson CC
Cancer research 2008 Aug 1;68(15):6407-15
Cancer research 2008 Aug 1;68(15):6407-15
No comments: Submit comment
No validations: Submit validation data