HPA031068

antibody from Atlas Antibodies

Targeting: CTSA GSL, PPGB

Antibody data

Submit

Validation data

Product number: HPA031068 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA031068, RRID:AB_10601205
Product name: Anti-CTSA
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: PCTNTTAASTYLNNPYVRKALNIPEQLPQWDMCNF LVNLQYRRLYRSMNSQYLKLLSSQKYQILLYNGDV DMACNFMGDEWFVDSLNQKMEVQRRPWLVKYGDSG EQIAGFVKEFSHIAFLTIKGAGHMVPTDKPLAA
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

CTSA protein structure - HPA031068 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human kidney and skeletal muscle tissues using HPA031068 antibody. Corresponding CTSA RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in renal tubules.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney shows moderate to strong granular cytoplasmic positivity in cells in tubules.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis shows strong granular cytoplasmic positivity in Leydig cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human rectum shows moderate granular cytoplasmic positivity in glandular cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skeletal muscle shows only very weak positivity in striated muscle fibers as expected.
Sample type: HUMAN