Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [5]
- Comments [0]
- Validations
- Western blot [2]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00054821-D01P - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00054821-D01P, RRID:AB_1573439
- Product name
- ERCC6L purified MaxPab rabbit polyclonal antibody (D01P)
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against a full-length human ERCC6L protein.
- Antigen sequence
MEKSFATKNEAVQKETLQEGPKQEALQEDPLESFN
YVLSKSTKADIGPNLDQLKDDEILRHCNPWPIISI
TNESQNAESNVSIIEIADDLSASHSALQDAQASEA
KLEEEPSASSPQYACDFNLFLEDSADNRQNFSSQS
LEHVEKENSLCGSAPNSRAGFVHSKTCLSWEFSEK
DDEPEEVVVKAKIRSKARRIVSDGEDEDDSFKDTS
SINPFNTSLFQFSSVKQFDASTPKNDISPPGRFFS
SQIPSSVNKSMNSRRSLASRRSLINMVLDHVEDME
ERLDDSSEAKGPEDYPEEGVEESSGEASKYTEEDP
SGETLSSENKSSWLMTSKPSALAQETSLGAPEPLS
GEQLVGSPQDKAAEATNDYETLVKRGKELKECGKI
QEALNCLVKALDIKSADPEVMLLTLSLYKQLNNN- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references PTEN stabilizes TOP2A and regulates the DNA decatenation.
A concomitant loss of dormant origins and FANCC exacerbates genome instability by impairing DNA replication fork progression.
Bloom's syndrome and PICH helicases cooperate with topoisomerase IIα in centromere disjunction before anaphase.
RING finger nuclear factor RNF168 is important for defects in homologous recombination caused by loss of the breast cancer susceptibility factor BRCA1.
The relative efficiency of homology-directed repair has distinct effects on proper anaphase chromosome separation.
Kang X, Song C, Du X, Zhang C, Liu Y, Liang L, He J, Lamb K, Shen WH, Yin Y
Scientific reports 2015 Dec 10;5:17873
Scientific reports 2015 Dec 10;5:17873
A concomitant loss of dormant origins and FANCC exacerbates genome instability by impairing DNA replication fork progression.
Luebben SW, Kawabata T, Johnson CS, O'Sullivan MG, Shima N
Nucleic acids research 2014 May;42(9):5605-15
Nucleic acids research 2014 May;42(9):5605-15
Bloom's syndrome and PICH helicases cooperate with topoisomerase IIα in centromere disjunction before anaphase.
Rouzeau S, Cordelières FP, Buhagiar-Labarchède G, Hurbain I, Onclercq-Delic R, Gemble S, Magnaghi-Jaulin L, Jaulin C, Amor-Guéret M
PloS one 2012;7(4):e33905
PloS one 2012;7(4):e33905
RING finger nuclear factor RNF168 is important for defects in homologous recombination caused by loss of the breast cancer susceptibility factor BRCA1.
Muñoz MC, Laulier C, Gunn A, Cheng A, Robbiani DF, Nussenzweig A, Stark JM
The Journal of biological chemistry 2012 Nov 23;287(48):40618-28
The Journal of biological chemistry 2012 Nov 23;287(48):40618-28
The relative efficiency of homology-directed repair has distinct effects on proper anaphase chromosome separation.
Laulier C, Cheng A, Stark JM
Nucleic acids research 2011 Aug;39(14):5935-44
Nucleic acids research 2011 Aug;39(14):5935-44
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of ERCC6L expression in transfected 293T cell line (H00054821-T02) by ERCC6L MaxPab polyclonal antibody.Lane 1: ERCC6L transfected lysate(46.20 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- ERCC6L MaxPab rabbit polyclonal antibody. Western Blot analysis of ERCC6L expression in human colon.
