Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00010491-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00010491-M01, RRID:AB_565612
- Product name
- CRTAP monoclonal antibody (M01), clone 4D9
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant CRTAP.
- Antigen sequence
KLNDLKNAAPCAVSYLLFDQNDKVMQQNLVYYQYH
RDTWGLSDEHFQPRPEAVQFFNVTTLQKELYDFAK
ENIMDDDEGEVVEYVDDLLELEETS- Isotype
- IgG
- Antibody clone number
- 4D9
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Prolyl 3-hydroxylase 1 and CRTAP are mutually stabilizing in the endoplasmic reticulum collagen prolyl 3-hydroxylation complex.
Severe osteogenesis imperfecta in cyclophilin B-deficient mice.
Chang W, Barnes AM, Cabral WA, Bodurtha JN, Marini JC
Human molecular genetics 2010 Jan 15;19(2):223-34
Human molecular genetics 2010 Jan 15;19(2):223-34
Severe osteogenesis imperfecta in cyclophilin B-deficient mice.
Choi JW, Sutor SL, Lindquist L, Evans GL, Madden BJ, Bergen HR 3rd, Hefferan TE, Yaszemski MJ, Bram RJ
PLoS genetics 2009 Dec;5(12):e1000750
PLoS genetics 2009 Dec;5(12):e1000750
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- CRTAP monoclonal antibody (M01), clone 4D9 Western Blot analysis of CRTAP expression in HeLa ( Cat # L013V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged CRTAP is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to CRTAP on formalin-fixed paraffin-embedded human kidney. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol