HPA031314

antibody from Atlas Antibodies

Targeting: PGD

Antibody data

Submit

Validation data

Product number: HPA031314 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA031314, RRID:AB_10610278
Product name: Anti-PGD
Antibody type: Polyclonal
Reactivity: Human, Mouse
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: FNRTVSKVDDFLANEAKGTKVVGAQSLKEMVSKLK KPRRIILLVKAGQAVDDFIEKLVPLLDTGDIIIDG GNSEYRDTTRRCRDLKAKGILFVGS
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

PGD protein structure - HPA031314 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human esophagus and skeletal muscle tissues using Anti-PGD antibody. Corresponding PGD RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human esophagus, liver, lymph node and testis using Anti-PGD antibody HPA031314 (A) shows similar protein distribution across tissues to independent antibody HPA031315 (B).
Antibody #2 product nr: HPA031315
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human esophagus shows strong cytoplasmic and additional nuclear positivity in squamous epithelial cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human esophagus shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skeletal muscle shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lymph node using Anti-PGD antibody HPA031314.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis using Anti-PGD antibody HPA031314.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver using Anti-PGD antibody HPA031314.
Sample type: HUMAN