Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN1449845 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Zinc Finger Protein 680 (ZNF680) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- A synthetic peptide directed towards the N-terminal region of human ZNF680
- Description
- Peptide immunoaffinity column
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
RGYGKCGHENLQLRISCKSVDESKVFKEGYNELNQ
CLRTTQSKIFQCDKY- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1.0 mg/mL after reconstitution
- Storage
- Store lyophilized at 2-8°C or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for up to one month or (in aliquots) at -20°C long term.
- Handling
- Avoid repeated freezing and thawing.
Submitted references High-throughput sequencing of complete human mtDNA genomes from the Philippines.
Gunnarsdóttir ED, Li M, Bauchet M, Finstermeier K, Stoneking M
Genome research 2011 Jan;21(1):1-11
Genome research 2011 Jan;21(1):1-11
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Human 721_B; WB Suggested Anti-ZNF680 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: 721_B cell lysate; ZNF680 antibody - N-terminal region (AP43732PU-N) in Human 721_B cells using Western Blot