Home > Search result > TENT4B > HPA042968

HPA042968

antibody from Atlas Antibodies

Targeting: TENT4B PAPD5, TRF4-2, TUT3

Provider product page for HPA042968

Immunohistochemistry

Antibody data

Antibody Data
Antigen structure
References [0]
Comments [0]
Validations
Immunohistochemistry [9]

Submit

Validation data

Product number: HPA042968 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA042968, RRID:AB_2678244
Product name: Anti-PAPD5
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: QSSSSDVDSDATPCKTPKQLLCRPSTGNRVGSQDV SLESSQAVGKMQSTQTTNTSNSTNKSQHGSARLFR SSSKGFQGTTQTSH
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

TENT4B protein structure - HPA042968 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human cervix, uterine and skeletal muscle tissues using HPA042968 antibody. Corresponding PAPD5 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

: Show more

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney shows cytoplasmic positivity in cells in tubules.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cervix, uterine shows positivity in squamous epithelial cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skeletal muscle shows no cytoplasmic positivity in myocytes.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human endometrium shows weak to moderate nuclear positivity in glandular cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis shows weak to moderate nuclear positivity in cells in seminiferous ducts.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cervix, uterine shows strong cytoplasmic positivity in squamous epithelial cells.
Sample type: HUMAN