HPA038059

antibody from Atlas Antibodies

Targeting: CSE1L CAS, CSE1, XPO2

Antibody data

Submit

Validation data

Product number: HPA038059 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA038059, RRID:AB_2675811
Product name: Anti-CSE1L
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: NTLTSICEKVIVPNMEFRAADEEAFEDNSEEYIRR DLEGSDIDTRRRAACDLVRGLCKFFEGPVTGIFSG YVNSMLQEYAKNPSVNWKHKDAA
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

CSE1L protein structure - HPA038059 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human testis and pancreas tissues using Anti-CSE1L antibody. Corresponding CSE1L RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex, colon, liver and testis using Anti-CSE1L antibody HPA038059 (A) shows similar protein distribution across tissues to independent antibody HPA038060 (B).
Antibody #2 product nr: HPA038060
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human pancreas shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon using Anti-CSE1L antibody HPA038059.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex using Anti-CSE1L antibody HPA038059.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver using Anti-CSE1L antibody HPA038059.
Sample type: HUMAN