AMAb91133

antibody from Atlas Antibodies

Targeting: LAMA4 LAMA3

Western blot (Supportive data in Antibodypedia)

Immunohistochemistry (Supportive data in Antibodypedia)

Antibody Data

Product number

AMAb91133

Provider

Atlas Antibodies

Proper citation

Atlas Antibodies Cat#AMAb91133, RRID:AB_2665813

Product name

Anti-LAMA4

Antibody type

Monoclonal

Reactivity

Human, Mouse, Rat

Host

Mouse

Conjugate

Unconjugated

Antigen sequence

ENLLNQARELQAKAESSSDEAVADTSRRVGGALAR
KSALKTRLSDAVKQLQAAERGDAQQRLGQSRLITE
EANRTTMEVQQATAPMANNLTNWSQNLQHFDSSAY
NTAVNSARDAVRNLTEVVPQLLDQLRTVEQKRPAS


Epitope

Binds to an epitope located within the peptide sequence MANNLTNWSQNLQHF as determined by overlapping synthetic peptides.

Isotype

IgG

Antibody clone number

CL3183

Vial size

100 µl

Storage

Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Western blot

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Western blot analysis of purified human recombinant Laminin-411, Laminin-421, Laminin-511, Laminin-121, Laminin-221 and Laminin-332.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Western blot analysis in human placenta tissue.

Immunohistochemistry

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human colon shows strong immunoreactivity in basement membrane of glandular epithelium.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human prostate shows moderate membranous positivity in smooth muscle cells.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human pancreas shows strong immunoreactivity in basement membrane of glandular epithelium.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human placenta shows strong positivity in basement membrane and endothelium.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human lymph node shows absence of immunoreactivity in lymphoid tissue (negative control).

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of rat stomach shows immunoreactivity in the basement membrane of glandular epithelium.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of rat heart muscle shows membranous positivity in cardiomyocytes.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of rat kidney shows basement membrane immunoreactivity in renal tubules and glomeruli.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of rat epididymis shows strong immunoreactivity in lamina propria.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of rat rectum shows immunoreactivity in the basement membrane of glandular epithelium.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of mouse stomach shows positivity in the basement membrane of glandular epithelium.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of mouse epididymis shows immunoreactivity in smooth muscle in the lamina propria.