Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN310578 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Retinal Outer Segment Membrane Protein 1 (ROM1) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ROM1 antibody: synthetic peptide directed towards the middle region of human ROM1
- Reactivity
- Human, Mouse, Rat, Bovine
- Host
- Rabbit
- Antigen sequence
NPHSPRPCLQNRLSDSYAHPLFDPRQPNQNLWAQG
CHEVL LEHLQDLAGT- Vial size
- 50 µg
Submitted references Human chromosome 11 DNA sequence and analysis including novel gene identification.
Taylor TD, Noguchi H, Totoki Y, Toyoda A, Kuroki Y, Dewar K, Lloyd C, Itoh T, Takeda T, Kim DW, She X, Barlow KF, Bloom T, Bruford E, Chang JL, Cuomo CA, Eichler E, FitzGerald MG, Jaffe DB, LaButti K, Nicol R, Park HS, Seaman C, Sougnez C, Yang X, Zimmer AR, Zody MC, Birren BW, Nusbaum C, Fujiyama A, Hattori M, Rogers J, Lander ES, Sakaki Y
Nature 2006 Mar 23;440(7083):497-500
Nature 2006 Mar 23;440(7083):497-500
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting