HPA041874

antibody from Atlas Antibodies

Targeting: RHCG C15orf6, PDRC2, RHGK, SLC42A3

Antibody data

Submit

Validation data

Product number: HPA041874 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA041874, RRID:AB_2677719
Product name: Anti-RHCG
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: LPFWGQPSDENCFEDAVYWEMPEGNSTVYIPEDPT FKPSGPSVPSVPMVSPLPMASSV
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

RHCG protein structure - HPA041874 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human esophagus and rectum tissues using Anti-RHCG antibody. Corresponding RHCG RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human colon, esophagus, kidney and lymph node using Anti-RHCG antibody HPA041874 (A) shows similar protein distribution across tissues to independent antibody HPA043317 (B).
Antibody #2 product nr: HPA043317
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human oral mucosa shows strong membranous and cytoplasmic positivity in superficial squamous epithelial cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human esophagus shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human rectum shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lymph node using Anti-RHCG antibody HPA041874.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney using Anti-RHCG antibody HPA041874.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon using Anti-RHCG antibody HPA041874.
Sample type: HUMAN