Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- LS-B13259 - Provider product page
- Provider
- LSBio
- Product name
- Anti-MSRB3 Antibody IHC-plus™ LS-B13259
- Antibody type
- Polyclonal
- Antigen
- Synthetic peptide directed towards the following sequence ESAFEGEYTHHKDPGIYKCVVCGTPLFKSETKFDSGSGWPSFHDVINSEA
- Description
- Immunoaffinity purified
- Reactivity
- Human, Mouse, Rat, Bovine, Guinea Pig, Horse, Rabbit
- Host
- Rabbit
- Vial size
- 50µg
- Storage
- Short term +4°C (no longer than one week); Long term -20°C; Aliquot to avoid freeze/thaw cycles.
No comments: Submit comment
No validations: Submit validation data