Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00027129-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00027129-M01, RRID:AB_464219
- Product name
- HSPB7 monoclonal antibody (M01), clone 3E11
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant HSPB7.
- Antigen sequence
MSHRTSSTFRAERSFHSSSSSSSSSTSSSASRALP
AQDPPMEKALSMFSDDFGSFMRPHSEPLAFPARPG
GAGNIKTLGDAYEFAVDVRDFSPEDIIVTTSNNHI
EVRAEKLAADGTVMNTFAHKCQLPEDVDPTSVTSA
LREDGSLTIRARRHPHTEHVQQTFRTEIKI- Isotype
- IgG
- Antibody clone number
- 3E11
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references HSPA1A-independent suppression of PARK2 C289G protein aggregation by human small heat shock proteins.
A PCR amplification strategy for unrestricted generation of chimeric genes.
Minoia M, Grit C, Kampinga HH
Molecular and cellular biology 2014 Oct 1;34(19):3570-8
Molecular and cellular biology 2014 Oct 1;34(19):3570-8
A PCR amplification strategy for unrestricted generation of chimeric genes.
Vos MJ, Kampinga HH
Analytical biochemistry 2008 Sep 15;380(2):338-40
Analytical biochemistry 2008 Sep 15;380(2):338-40
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- HSPB7 monoclonal antibody (M01), clone 3E11. Western Blot analysis of HSPB7 expression in human colon.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged HSPB7 is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to HSPB7 on formalin-fixed paraffin-embedded human heart. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol
