Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00065009-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00065009-M01, RRID:AB_437122
- Product name
- NDRG4 monoclonal antibody (M01), clone 2G3
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant NDRG4.
- Antigen sequence
MPECWDGEHDIETPYGLLHVVIRGSPKGNRPAILT
YHDVGLNHKLCFNTFFNFEDMQEITKHFVVCHVDA
PGQQVGASQFPQGYQFPSMEQLAAMLPSVVQHFGF
KYVIGIGVGAGAYVLAKFALIFPDLVEGLVLVNID
PNGKGWIDWAATKLSGLTSTLPDTVLSHLFSQEEL
VNNTELVQSYRQQIGNVVNQANLQLFWNMYNSRRD
LDINRPGTVPNAKTLRCPVMLVVGDNAPAEDGVVE
CNSKLDPTTTTFLKMADSGGLPQVTQPGKLTEAFK
YFLQGMGYMPSASMTRLARSRTASLTSASSVDGSR
PQACTHSESSEGLGQVNHTMEVSC- Isotype
- IgG
- Antibody clone number
- 2G3
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references NDRG4 is downregulated in glioblastoma and inhibits cell proliferation.
N-Myc downstream-regulated gene 4 (NDRG4): a candidate tumor suppressor gene and potential biomarker for colorectal cancer.
Identification and action of N-myc downstream regulated gene 4 A2 in rat pancreas.
Ding W, Zhang J, Yoon JG, Shi D, Foltz G, Lin B
Omics : a journal of integrative biology 2012 May;16(5):263-7
Omics : a journal of integrative biology 2012 May;16(5):263-7
N-Myc downstream-regulated gene 4 (NDRG4): a candidate tumor suppressor gene and potential biomarker for colorectal cancer.
Melotte V, Lentjes MH, van den Bosch SM, Hellebrekers DM, de Hoon JP, Wouters KA, Daenen KL, Partouns-Hendriks IE, Stessels F, Louwagie J, Smits KM, Weijenberg MP, Sanduleanu S, Khalid-de Bakker CA, Oort FA, Meijer GA, Jonkers DM, Herman JG, de Bruïne AP, van Engeland M
Journal of the National Cancer Institute 2009 Jul 1;101(13):916-27
Journal of the National Cancer Institute 2009 Jul 1;101(13):916-27
Identification and action of N-myc downstream regulated gene 4 A2 in rat pancreas.
Wang JF, Hill DJ
The Journal of endocrinology 2009 Apr;201(1):15-25
The Journal of endocrinology 2009 Apr;201(1):15-25
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- NDRG4 monoclonal antibody (M01), clone 2G3. Western Blot analysis of NDRG4 expression in Raw 264.7.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged NDRG4 is approximately 3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to NDRG4 on formalin-fixed paraffin-embedded human colon adenocarcinoma. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol
