Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00339318-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00339318-M01, RRID:AB_581614
- Product name
- ZNF181 monoclonal antibody (M01), clone 5F1
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant ZNF181.
- Antigen sequence
FIHRSSLIHHQKIHTGEKPYECRECGKAFCCSSHL
TRHQRIHTMEKQYECNKCLKVFSSLSFLVQHQSIH
TEEKPFECQKCRKSFNQLESLNMHLRNHIRLKPYE
CSI- Isotype
- IgG
- Antibody clone number
- 5F1
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- ZNF181 monoclonal antibody (M01), clone 5F1 Western Blot analysis of ZNF181 expression in A-431 ( Cat # L015V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to ZNF181 on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol