HPA041178

antibody from Atlas Antibodies

Targeting: NAE1 APP-BP1, APPBP1, ula-1

Antibody data

Submit

Validation data

Product number: HPA041178 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA041178, RRID:AB_10964773
Product name: Anti-NAE1
Antibody type: Polyclonal
Reactivity: Human, Mouse, Rat
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: PSFWILARALKEFVAKEGQGNLPVRGTIPDMIADS GKYIKLQNVYREKAKKDAAAVGNHVAKLLQSIGQA PESISEKELKLLCSNSAFLRVVRCRSLAEEYGLDT INKDE
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

NAE1 protein structure - HPA041178 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex, colon, liver and testis using Anti-NAE1 antibody HPA041178 (A) shows similar protein distribution across tissues to independent antibody HPA042041 (B).
Antibody #2 product nr: HPA042041
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebellum shows strong nuclear positivity in Purkinje cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver using Anti-NAE1 antibody HPA041178.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis using Anti-NAE1 antibody HPA041178.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex using Anti-NAE1 antibody HPA041178.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon using Anti-NAE1 antibody HPA041178.
Sample type: HUMAN