Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN183236 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Zona Pellucida Glycoprotein 3 (ZP3) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ZP3 antibody: synthetic peptide directed towards the C terminal of human ZP3
- Description
- Protein A purified
- Reactivity
- Human, Bovine, Rabbit
- Host
- Rabbit
- Antigen sequence
NKGDCGTPSHSRRQPHVMSQWSRSASRNRRHVTEE
ADVTV GATDLPGQEW- Epitope
- C-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Zona pellucida components are present in human fetal ovary before follicle formation.
Human homolog of the mouse sperm receptor.
Törmälä RM, Jääskeläinen M, Lakkakorpi J, Liakka A, Tapanainen JS, Vaskivuo TE
Molecular and cellular endocrinology 2008 Jul 16;289(1-2):10-5
Molecular and cellular endocrinology 2008 Jul 16;289(1-2):10-5
Human homolog of the mouse sperm receptor.
Chamberlin ME, Dean J
Proceedings of the National Academy of Sciences of the United States of America 1990 Aug;87(16):6014-8
Proceedings of the National Academy of Sciences of the United States of America 1990 Aug;87(16):6014-8
No comments: Submit comment
No validations: Submit validation data