HPA032122

antibody from Atlas Antibodies

Targeting: PPY PNP

Antibody data

Submit

Validation data

Product number: HPA032122 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA032122, RRID:AB_2674164
Product name: Anti-PPY
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: EPVYPGDNATPEQMAQYAADLRRYINMLTRPRYGK RHKEDTLAFSEWGSPHAAVPRELSPLDL
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

PPY protein structure - HPA032122 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human pancreas and liver tissues using HPA032122 antibody. Corresponding PPY RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human pancreas shows strong positivity in a subset of cells in islets of Langerhans.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human pancreas shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver shows no extracellular space positivity in hepatocytes as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human pancreas shows strong extracellular space positivity in islets of Langerhans.
Sample type: HUMAN